Ray White Real Estate Commercial Glen Waverley
raywhitecommercialglenwaverley.com/
Ray White Commercial Glen Waverley is part of Australia and New Zealand's largest Real Estate group for residential, commercial or rural property to ...
- Avoid using deprecated HTML tags.
- Try to make your site load faster.
URL
Domain : raywhitecommercialglenwaverley.com/
Character length : 35
Title
Ray White Real Estate Commercial Glen Waverley
Description
Ray White Commercial Glen Waverley is part of Australia and New Zealand's largest Real Estate group for residential, commercial or rural property to buy, rent or lease, call (03) 9574 9555.
Keywords (meta keywords)
Ray White, raywhite, ray, white, Commercial Glen Waverley, Camberwell Clayton Clayton South Coburg North Dandenong Docklands Glen Waverley Knoxfield Lilydale Melbourne Mordialloc Mulgrave Notting Hill
Error! Using “meta keywords” is meaningless in a while.
Error! Using “meta keywords” is meaningless in a while.
Open Graph Protocol
Good! The OG (Open Graph) protocol is set on this website.
title: Ray White Real Estate Commercial Glen Waverley
site_name: Ray White Real Estate Commercial Glen Waverley
url: http://raywhitecommercialglenwaverley.com/
type: business.business
Dublin Core
Dublin Core is not used
Underscores in the URLs
Good! No underscore (_) found in the URLs.
Search engine friendly URLs
Good! The website uses SEO friendly URLs.
Checking the robots.txt file
There is robots.txt file.
https://raywhitecommercialglenwaverley.com/robots.txt
https://raywhitecommercialglenwaverley.com/robots.txt
User-agent | Disallowed for the search engines |
---|---|
* |
|
ia_archiver |
|
archive.org_bot |
|
Social Engagement
No info found.
Doctype
HTML 5
Encoding
Perfect! The character encoding is set: UTF-8.
Language
We have found the language localisation: ”en”.
Title
Ray White Real Estate Commercial Glen Waverley
Character length : 46
Good! The title’s length is between 10 and 70 characters.
Character length : 46
Good! The title’s length is between 10 and 70 characters.
Text / HTML ratio
Ratio : 8%
Error! The text / HTML code ratio is under 15 percent on this website. This value shows that the website has relatively few text content.
Error! The text / HTML code ratio is under 15 percent on this website. This value shows that the website has relatively few text content.
Headings
H1 | H2 | H3 | H4 | H5 | H6 |
---|---|---|---|---|---|
0 | 0 | 14 | 10 | 0 | 0 |
Heading structure in the source code
- <H3> 1369 Toorak Road, Camberwell, VIC
- <H4> Ready to Start Trading!
- <H3> 56 John Street, Lilydale, VIC
- <H4> Smashing Investment with Development Upside
- <H3> 2/1668-1670 Centre Road, Springvale, VIC
- <H4> High Profile Level 1 Office Space
- <H3> 1/344 Ferntree Gully Road, Notting Hill, VIC
- <H4> Flexible Office or Showroom
- <H3> Level 1, 191 Coleman Parade, Glen Waverley, VIC
- <H4> The Cheapest Office in Central Glen Waverley!
- <H3> Level 8, 52 Montclair Avenue, Glen Waverley, VIC
- <H4> Exclusive Rooftop Restaurant/Bar
- <H3> 17 Hampshire Road, Glen Waverley, VIC
- <H4> Long Standing Medical, with Endless Possibilities
- <H3> 476 Blackburn Road, Glen Waverley, VIC
- <H4> Newly Constructed Main Road Medical/Office
- <H3> 9 Bennet Street, Dandenong, VIC
- <H4> High Profile Corner Location
- <H3> 32/266 Osborne Avenue, Clayton South, VIC
- <H4> Cheap Rent & Ready to Move in! (Freezer & Cool Room Available)
- <H3> Search BusinessCommercialLandCommercial Properties
- <H3> Keyword & Property ID Search
- <H3> Ray White Commercial Glen Waverley
- <H3> What's your property worth?
Word cloud
- details20
- glen18
- waverley17
- lease16
- road15
- vic12
- commercial12
- sale9
- property9
- office7
- high6
- medical5
- hill5
- benefit5
- white5
- located5
- south5
- ray5
- avenue5
- centre5
- clayton5
- location4
- level4
- springvale4
- inspection4
- open4
- parade3
- rent3
- price3
- recent3
- coleman3
- profile3
- all3
- most3
- ready3
- investment3
- space3
- wheelers3
- street3
- offer3
- lilydale3
- being2
- advantage2
- notting2
- ample2
- businesses2
- next2
- development2
- upside2
- knoxfield2
- jells2
- established2
- restaurant/bar2
- search2
- transactions2
- business2
- first2
- floor2
- address2
- auction2
Keyword matrix
word | title | descriptions | heading |
---|---|---|---|
details | |||
glen | |||
waverley | |||
lease | |||
road | |||
vic |
Two Word cloud
- for lease8
- lease details7
- for sale6
- glen waverley6
- road for3
- added benefit2
Three Word cloud
- commercial property for2
- for inspection auction2
- vic high profile2
- for lease details2
- for inspection recent2
- jells road for2
404 Page
The website has a 404 error page.
Flash content
Good! The website does not have any flash contents.
Frame
Good! The website does not use iFrame solutions.
Images
We found 21 images on this web page.
Alternate attributes for the following 1 images are missing. Search engines use "alt" tags to understand image content efficiently. We strongly recommend fixing this issue.
Alternate attributes for the following 1 images are missing. Search engines use "alt" tags to understand image content efficiently. We strongly recommend fixing this issue.
Flesch–Kincaid Grade Level
4.50
Flesch Reading Ease
71.30
Coleman Liau Index
12.00
Automated Readability Index (ARI)
3.80
Dale–Chall Readability
7.00
SMOG Index
8.80
Spache Readibility
5.00
Number of letters
4118
Number of words
851
Number of sentences
174
Average words per sentences
5
Number of syllables
1313
Syllables in words
1355
Average syllables in words
1.54
Number of words in first three syllables
165
Percentage of word / syllables
19.39
Words not in Dale-Chall easy-word list
362
Words not in Spache easy-word list
211
Mobile optimization
This website is optimal for mobile devices!
Deprecated HTML elements
Good! No deprecated HTML tags are detected.
Redirection (www / not www)
Good! The web address is accessible in only one version. The www version is redirected to the version without www.
Deprecated HTML elements
Good! No deprecated HTML tags are detected.
Printability
Suggestion! Unfortunately, no printer-friendly CSS found.
Meta Tag (viewport tag, mobile devices)
Error! The meta tag named viewport is missing.
Server response time
The server response time is fast enough.
Loading time
6,269 ms
Table layout
Good! No nested tables found.
Render blocking resources
Good! No render blocking elements found!
Javascript
Error! Too many javascript files found which slows down the page load on the website.
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/libs/jquery-1.7.2.min.js?ver=edb38857
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/libs/rw.namespaces.js?ver=59f8e825
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/libs/rw.widget.js?ver=a86b268e
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/libs/rw.streetadvisor.js?ver=a5cbf7ad
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/bootstrap/dist/js/bootstrap.min.js?ver=a5f63f70
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/bootstrap/js/transition.js?ver=31325f20
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/modernizr-1.7.min.js
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/libs/uif.common.js?ver=10bf47b3
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword/js/jcarousellite_1.0.1.js?ver=dd01b45e
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/jquery.cycle.lite.js?ver=611c728f
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/rwo.hero.js?ver=ed40c854
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/rwo.lazy.load.js?ver=edd6cce8
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/bind.js?ver=65229ee2
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/lib/jquery.multiselect.js?ver=de93655b
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/rwo.property.js?ver=1343de23
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/js/broadsword_child5.js?ver=c299e75f
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/jquery.ba-hashchange.min.js?ver=dd14041d
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/rwo.property.load.js?ver=bfd1faf8
- http://raywhitecommercialglenwaverley.com/wp-content/resources/js/rwo.contact.js?ver=86568fe8
- http://raywhitecommercialglenwaverley.com/wp-content/resources/uiframework/js/thirdparty/jquery.validate-1.11.1.min.js
File size of all javascript files combined
0.00
Javascript minifying
Great! The Javascript files are minified.
CSS
Error! Too many CSS files detected that slows down the page load.
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword/style.css?ver=d2b13ed6
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/style.css?ver=09f3567c
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/theme.css?ver=30c7edaa
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/style-media.css?ver=9866805d
- http://raywhitecommercialglenwaverley.com/wp-content/resources/css/jquery-ui.css?ver=169b988d
- http://raywhitecommercialglenwaverley.com/wp-content/resources/css/rwo-jquery-ui.css?ver=1c2f02bf
- http://raywhitecommercialglenwaverley.com/wp-content/resources/css/jquery.multiselect.css?ver=ff8336cb
- http://raywhitecommercialglenwaverley.com/wp-content/resources/colorbox/example1/colorbox.css?ver=6c0cbe37
- http://raywhitecommercialglenwaverley.com/wp-content/themes/broadsword_child5/local/local.css?ver=a5e8b6d9
File size of all css files combined
0.00
CSS minifying
Great! The CSS elements are minified.
Uncompressed size of the of the HTML
0.00
Gzip compression
Your site uses compression.
Browser cache
The browser cache is set correctly for all elements.
File size of all images combined
0.00
Image optimisation
All images are optimized.
We found a total of 106 different links.
Internal links: 98
External links: 8
Internal links: 98
External links: 8
External links:
Link text (anchor) | Link strength |
---|---|
REAA | |
Terms of Use | |
Privacy | |
Legal | |
T&C | |
Disclaimer | |
enable javascript |
Internal links:
IP
54.252.204.163
External hidden links
Good! No hidden external links found
Looking for eval()
Good! No eval(bas64_decode()) scripts are found
Checking for XSS vulnerability
No XSS vulnerability found
Email encryption
Warning! The website contains at least one unencrypted email address.
Favicon
Good! The website uses favicon.
- H3 : 45/195 Wellington Road, Clayton, VIC, ( 0px from top )
- H4 : Light and Bright Office Space, ( 0px from top )
- H3 : 21 Longford Court, Springvale, VIC, ( 0px from top )
- H4 : Great Value Warehouse Opportunity, ( 0px from top )
- H3 : 99-101 Gladstone Road, Dandenong North, VIC, ( 0px from top )
- H4 : High Profile Investment with Development Upside, ( 0px from top )
- H3 : 1369 Toorak Road, Camberwell, VIC, ( 0px from top )
- H4 : Ready to Start Trading!, ( 0px from top )
- H3 : 2/1668-1670 Centre Road, Springvale, VIC, ( 0px from top )
- H4 : High Profile Level 1 Office Space, ( 0px from top )
- H3 : 1/344 Ferntree Gully Road, Notting Hill, VIC, ( 0px from top )
- H4 : Flexible Office or Showroom, ( 0px from top )
- H3 : Level 1, 191 Coleman Parade, Glen Waverley, VIC, ( 0px from top )
- H4 : The Cheapest Office in Central Glen Waverley!, ( 0px from top )
- H3 : Level 8, 52 Montclair Avenue, Glen Waverley, VIC, ( 0px from top )
- H4 : Exclusive Rooftop Restaurant/Bar, ( 0px from top )
- H3 : 17 Hampshire Road, Glen Waverley, VIC, ( 0px from top )
- H4 : Long Standing Medical, with Endless Possibilities, ( 0px from top )
- H3 : 476 Blackburn Road, Glen Waverley, VIC, ( 0px from top )
- H4 : Newly Constructed Main Road Medical/Office, ( 0px from top )
- H3 : Search Business Commercial Land Commercial Properties , ( 938.078125px from top )
- H3 : Keyword & Property ID Search, ( 1341.828125px from top )
aywhitecommercialglenwaverley.com, reaywhitecommercialglenwaverley.com, eaywhitecommercialglenwaverley.com, rdaywhitecommercialglenwaverley.com, daywhitecommercialglenwaverley.com, rfaywhitecommercialglenwaverley.com, faywhitecommercialglenwaverley.com, r4,aywhitecommercialglenwaverley.com, 4,aywhitecommercialglenwaverley.com, rtaywhitecommercialglenwaverley.com, taywhitecommercialglenwaverley.com, r5aywhitecommercialglenwaverley.com, 5aywhitecommercialglenwaverley.com, rywhitecommercialglenwaverley.com, raqywhitecommercialglenwaverley.com, rqywhitecommercialglenwaverley.com, rawywhitecommercialglenwaverley.com, rwywhitecommercialglenwaverley.com, razywhitecommercialglenwaverley.com, rzywhitecommercialglenwaverley.com, raywhitecommercialglenwaverley.com, rywhitecommercialglenwaverley.com, raxywhitecommercialglenwaverley.com, rxywhitecommercialglenwaverley.com, rasywhitecommercialglenwaverley.com, rsywhitecommercialglenwaverley.com, rawhitecommercialglenwaverley.com, raytwhitecommercialglenwaverley.com, ratwhitecommercialglenwaverley.com, raygwhitecommercialglenwaverley.com, ragwhitecommercialglenwaverley.com, rayhwhitecommercialglenwaverley.com, rahwhitecommercialglenwaverley.com, rayjwhitecommercialglenwaverley.com, rajwhitecommercialglenwaverley.com, rayuwhitecommercialglenwaverley.com, rauwhitecommercialglenwaverley.com, rayhitecommercialglenwaverley.com, raywqhitecommercialglenwaverley.com, rayqhitecommercialglenwaverley.com, raywahitecommercialglenwaverley.com, rayahitecommercialglenwaverley.com, raywshitecommercialglenwaverley.com, rayshitecommercialglenwaverley.com, raywdhitecommercialglenwaverley.com, raydhitecommercialglenwaverley.com, raywehitecommercialglenwaverley.com, rayehitecommercialglenwaverley.com, rayw1hitecommercialglenwaverley.com, ray1hitecommercialglenwaverley.com, rayw2hitecommercialglenwaverley.com, ray2hitecommercialglenwaverley.com, rayw3hitecommercialglenwaverley.com, ray3hitecommercialglenwaverley.com, raywitecommercialglenwaverley.com, raywhbitecommercialglenwaverley.com, raywbitecommercialglenwaverley.com, raywhgitecommercialglenwaverley.com, raywgitecommercialglenwaverley.com, raywhtitecommercialglenwaverley.com, raywtitecommercialglenwaverley.com, raywhyitecommercialglenwaverley.com, raywyitecommercialglenwaverley.com, raywhuitecommercialglenwaverley.com, raywuitecommercialglenwaverley.com, raywhjitecommercialglenwaverley.com, raywjitecommercialglenwaverley.com, raywhmitecommercialglenwaverley.com, raywmitecommercialglenwaverley.com, raywhnitecommercialglenwaverley.com, raywnitecommercialglenwaverley.com, raywhtecommercialglenwaverley.com, raywhiutecommercialglenwaverley.com, raywhutecommercialglenwaverley.com, raywhijtecommercialglenwaverley.com, raywhjtecommercialglenwaverley.com, raywhitecommercialglenwaverley.com, raywhtecommercialglenwaverley.com, raywhiltecommercialglenwaverley.com, raywhltecommercialglenwaverley.com, raywhiotecommercialglenwaverley.com, raywhotecommercialglenwaverley.com, raywhi8tecommercialglenwaverley.com, raywh8tecommercialglenwaverley.com, raywhi9tecommercialglenwaverley.com, raywh9tecommercialglenwaverley.com, raywhi*tecommercialglenwaverley.com, raywh*tecommercialglenwaverley.com, raywhiecommercialglenwaverley.com, raywhitrecommercialglenwaverley.com, raywhirecommercialglenwaverley.com, raywhitfecommercialglenwaverley.com, raywhifecommercialglenwaverley.com, raywhitgecommercialglenwaverley.com, raywhigecommercialglenwaverley.com, raywhithecommercialglenwaverley.com, raywhihecommercialglenwaverley.com, raywhityecommercialglenwaverley.com, raywhiyecommercialglenwaverley.com, raywhit5ecommercialglenwaverley.com, raywhi5ecommercialglenwaverley.com, raywhit6ecommercialglenwaverley.com, raywhi6ecommercialglenwaverley.com, raywhitcommercialglenwaverley.com, raywhitewcommercialglenwaverley.com, raywhitwcommercialglenwaverley.com, raywhitescommercialglenwaverley.com, raywhitscommercialglenwaverley.com, raywhitecommercialglenwaverley.com, raywhitcommercialglenwaverley.com, raywhitedcommercialglenwaverley.com, raywhitdcommercialglenwaverley.com, raywhitefcommercialglenwaverley.com, raywhitfcommercialglenwaverley.com, raywhitercommercialglenwaverley.com, raywhitrcommercialglenwaverley.com, raywhite3commercialglenwaverley.com, raywhit3commercialglenwaverley.com, raywhite4commercialglenwaverley.com, raywhit4commercialglenwaverley.com, raywhiteommercialglenwaverley.com, raywhitecxommercialglenwaverley.com, raywhitexommercialglenwaverley.com, raywhitecsommercialglenwaverley.com, raywhitesommercialglenwaverley.com, raywhitecommercialglenwaverley.com, raywhiteommercialglenwaverley.com, raywhitecdommercialglenwaverley.com, raywhitedommercialglenwaverley.com, raywhitecfommercialglenwaverley.com, raywhitefommercialglenwaverley.com, raywhitecvommercialglenwaverley.com, raywhitevommercialglenwaverley.com, raywhitec ommercialglenwaverley.com, raywhite ommercialglenwaverley.com, raywhitecmmercialglenwaverley.com, raywhitecoimmercialglenwaverley.com, raywhitecimmercialglenwaverley.com, raywhitecokmmercialglenwaverley.com, raywhiteckmmercialglenwaverley.com, raywhitecolmmercialglenwaverley.com, raywhiteclmmercialglenwaverley.com, raywhitecommercialglenwaverley.com, raywhitecmmercialglenwaverley.com, raywhitecopmmercialglenwaverley.com, raywhitecpmmercialglenwaverley.com, raywhiteco9mmercialglenwaverley.com, raywhitec9mmercialglenwaverley.com, raywhiteco0mmercialglenwaverley.com, raywhitec0mmercialglenwaverley.com, raywhitecomercialglenwaverley.com, raywhitecomnmercialglenwaverley.com, raywhiteconmercialglenwaverley.com, raywhitecomhmercialglenwaverley.com, raywhitecohmercialglenwaverley.com, raywhitecommercialglenwaverley.com, raywhitecomercialglenwaverley.com, raywhitecomjmercialglenwaverley.com, raywhitecojmercialglenwaverley.com, raywhitecomkmercialglenwaverley.com, raywhitecokmercialglenwaverley.com, raywhitecomlmercialglenwaverley.com, raywhitecolmercialglenwaverley.com, raywhitecom mercialglenwaverley.com, raywhiteco mercialglenwaverley.com